PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43044.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 231aa    MW: 26161.6 Da    PI: 9.6548
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43044.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed++l+d++k++G  +W+t ++  g++R++k+c++rw +yl
       KHN43044.1 13 KGAWSKQEDQKLIDYIKKHGEVCWRTLPQAAGLHRCGKSCRLRWINYL 60
                     79******************99************************97 PP

2Myb_DNA-binding51.52.4e-1666110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++
       KHN43044.1  66 RGNFAEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSH 110
                      8999******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.159860IPR017930Myb domain
SuperFamilySSF466895.35E-2811107IPR009057Homeodomain-like
SMARTSM007178.4E-141262IPR001005SANT/Myb domain
PfamPF002493.1E-141360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-221467IPR009057Homeodomain-like
CDDcd001671.34E-101560No hitNo description
PROSITE profilePS5129426.47961115IPR017930Myb domain
SMARTSM007173.0E-1565113IPR001005SANT/Myb domain
PfamPF002497.5E-1566110IPR001005SANT/Myb domain
CDDcd001677.87E-1168111No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2568116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MRKPSCDIKD LNKGAWSKQE DQKLIDYIKK HGEVCWRTLP QAAGLHRCGK SCRLRWINYL  60
RPDLKRGNFA EDEEDLIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH IRRKLISKGI  120
DPNNHRLKHT IPSSLQNSLM SDDSSKAFSM KDTNKNETSK LPRVYNHVEV SDAASGEAES  180
PCALPDLNLD LSITNPSASQ SISGNNVKPF HESNSSRKVQ FDSPSTLLLF Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-3181152108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1356031e-119BT135603.1 Lotus japonicus clone JCVI-FLLj-12J12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528525.11e-172PREDICTED: myb-related protein 308-like
SwissprotP813938e-78MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A0B2SFI21e-172A0A0B2SFI2_GLYSO; Myb-related protein 308
TrEMBLI1KM311e-172I1KM31_SOYBN; Uncharacterized protein
STRINGGLYMA07G33960.11e-171(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.11e-77myb domain protein 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]